PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08590g03016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 266aa    MW: 29332.3 Da    PI: 8.2117
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08590g03016.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.5e-403394263
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                              ke+a++cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Niben101Scf08590g03016.1 33 KEQAINCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 94
                              7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-273085IPR003851Zinc finger, Dof-type
PfamPF027019.8E-343591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1063791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDTSHWPQGI GLVKAVEPSK PLPATERKPR PQKEQAINCP RCNSTNTKFC YYNNYSLSQP  60
RYFCKTCRRY WTEGGSLRNV PVGGGSRKNK RSSSSSNNSS SSTSSSYKKI PDFTIPTSSS  120
QNPKILNEPH DLNLSFNPTT TSNFSNISEF MALPLMNPNS TTSFMSSIMP QLSDSNNIMH  180
SSSSTGLPNL HDLKPTLNFS WDGFDNNNGY GSLQGEATGA KLFFPLDDLK NVSTANDDHE  240
FDEQNRGQAA ESHGFWNGML GGGSSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801284.11e-170PREDICTED: dof zinc finger protein DOF1.8-like
RefseqXP_016497460.11e-170PREDICTED: dof zinc finger protein DOF1.8-like
TrEMBLA0A068PXR91e-170A0A068PXR9_TOBAC; Dof zinc finger protein
STRINGSolyc03g082840.2.13e-91(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-41Dof family protein